PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 166aa    MW: 18495.1 Da    PI: 10.3206
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510400.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.1e-1468112147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_016510400.1  68 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 112
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.92E-1762118IPR009057Homeodomain-like
PROSITE profilePS5129415.40863117IPR017930Myb domain
TIGRFAMsTIGR015574.6E-1966115IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.4E-766118IPR009057Homeodomain-like
SMARTSM007175.3E-1167115IPR001005SANT/Myb domain
PfamPF002498.8E-1268112IPR001005SANT/Myb domain
CDDcd001672.30E-970113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MVSVYPTPPA GQDFYYMGDP MKMGLPGLHS IQSGSNGASS HGNSNSGLVV PDDHNKKTRK  60
PYTITKSRES WTEQEHDKFL EALQLFDRDW KKIEAFVGSK TVIQIRSHAQ KYFLKVQKSG  120
TSEHVPPPRP KRKAAHPYPQ KAPKKVLSQV GSIQFQPPGA LPEPGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1416251e-127JX141625.1 Cestrum nocturnum MYB mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009617756.11e-119PREDICTED: protein REVEILLE 6
RefseqXP_016510400.11e-121PREDICTED: protein REVEILLE 3-like, partial
SwissprotQ6R0H06e-62RVE3_ARATH; Protein REVEILLE 3
TrEMBLK4AZP31e-100K4AZP3_SOLLC; Uncharacterized protein
STRINGSolyc01g095030.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.12e-47MYB_related family protein